Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,928
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,766
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 9,564
  4. Avatar for Ukraine 14. Ukraine 1 pt. 9,555
  5. Avatar for Biology 2 15. Biology 2 1 pt. 9,163
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 8,987
  7. Avatar for Window Group 17. Window Group 1 pt. 7,652
  1. Avatar for aznarog 31. aznarog Lv 1 26 pts. 9,982
  2. Avatar for fiendish_ghoul 32. fiendish_ghoul Lv 1 25 pts. 9,979
  3. Avatar for Phyx 33. Phyx Lv 1 23 pts. 9,977
  4. Avatar for guineapig 34. guineapig Lv 1 22 pts. 9,967
  5. Avatar for jausmh 35. jausmh Lv 1 21 pts. 9,950
  6. Avatar for diamonddays 36. diamonddays Lv 1 20 pts. 9,948
  7. Avatar for vuvuvu 37. vuvuvu Lv 1 19 pts. 9,928
  8. Avatar for detectorist 38. detectorist Lv 1 18 pts. 9,918
  9. Avatar for 181818 39. 181818 Lv 1 17 pts. 9,916
  10. Avatar for rezaefar 40. rezaefar Lv 1 16 pts. 9,914

Comments