Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,928
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,766
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 9,564
  4. Avatar for Ukraine 14. Ukraine 1 pt. 9,555
  5. Avatar for Biology 2 15. Biology 2 1 pt. 9,163
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 8,987
  7. Avatar for Window Group 17. Window Group 1 pt. 7,652
  1. Avatar for bobcat 81. bobcat Lv 1 1 pt. 9,507
  2. Avatar for dbuske 82. dbuske Lv 1 1 pt. 9,458
  3. Avatar for rinze 83. rinze Lv 1 1 pt. 9,437
  4. Avatar for xbp 84. xbp Lv 1 1 pt. 9,436
  5. Avatar for z5131k 85. z5131k Lv 1 1 pt. 9,371
  6. Avatar for jseckler 86. jseckler Lv 1 1 pt. 9,364
  7. Avatar for Philippe_C 87. Philippe_C Lv 1 1 pt. 9,342
  8. Avatar for Auntecedent 88. Auntecedent Lv 1 1 pt. 9,335
  9. Avatar for ManVsYard 89. ManVsYard Lv 1 1 pt. 9,328
  10. Avatar for petetrig 90. petetrig Lv 1 1 pt. 9,324

Comments