Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Go Science 100 pts. 10,177
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 10,144
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 10,129
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 10,129
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,116
  6. Avatar for Beta Folders 6. Beta Folders 16 pts. 10,109
  7. Avatar for Russian team 7. Russian team 10 pts. 10,074
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,061
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 10,016
  10. Avatar for Contenders 10. Contenders 2 pts. 10,001

  1. Avatar for PakElgaard 91. PakElgaard Lv 1 1 pt. 9,310
  2. Avatar for lange 92. lange Lv 1 1 pt. 9,294
  3. Avatar for dgklr 93. dgklr Lv 1 1 pt. 9,289
  4. Avatar for ChloricAcid 94. ChloricAcid Lv 1 1 pt. 9,270
  5. Avatar for kevin everington 95. kevin everington Lv 1 1 pt. 9,268
  6. Avatar for Anamfija 96. Anamfija Lv 1 1 pt. 9,249
  7. Avatar for Anonymous Folder 97. Anonymous Folder Lv 1 1 pt. 9,228
  8. Avatar for Xyaneon 98. Xyaneon Lv 1 1 pt. 9,212
  9. Avatar for Datstandin 99. Datstandin Lv 1 1 pt. 9,206
  10. Avatar for Andi1960 100. Andi1960 Lv 1 1 pt. 9,186

Comments