1750: Revisiting Puzzle 75: Antifreeze Protein
Closed since over 6 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- October 23, 2019
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA
Top groups
-
1. Go Science100 pts. 10,177
-
-
-
-
-
-
-
-
-
Comments
Anfinsen_slept_here Lv 1
This puzzle closed almost two days ago. No points are showing as having been awarded. Is anyone looking at this problem?
Anfinsen_slept_here Lv 1
This puzzle closed almost two days ago. No points are showing as having been awarded. Is anyone looking at this problem?