Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups

  1. Avatar for Contenders 11. Contenders 1 pt. 9,436
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,997
  3. Avatar for Ukraine 13. Ukraine 1 pt. 8,969
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 8,798
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,299
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  7. Avatar for Deleted group 17. Deleted group pts. 0
  1. Avatar for Anfinsen_slept_here
    1. Anfinsen_slept_here Lv 1
    100 pts. 10,206
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 97 pts. 10,182
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 93 pts. 10,022
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 89 pts. 10,020
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 86 pts. 9,999
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 82 pts. 9,989
  7. Avatar for Enzyme 7. Enzyme Lv 1 79 pts. 9,941
  8. Avatar for LociOiling 8. LociOiling Lv 1 76 pts. 9,939
  9. Avatar for Threeoak 9. Threeoak Lv 1 73 pts. 9,926
  10. Avatar for RockOn 10. RockOn Lv 1 70 pts. 9,910

Comments