Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups


  1. Avatar for Go Science 100 pts. 10,231
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,039
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 9,999
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,971
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,941
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,934
  7. Avatar for Russian team 7. Russian team 10 pts. 9,886
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,839
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,836
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,487

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,231
  2. Avatar for Hollinas 2. Hollinas Lv 1 83 pts. 10,228
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 68 pts. 10,224
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 55 pts. 10,221
  5. Avatar for Phyx 5. Phyx Lv 1 44 pts. 10,216
  6. Avatar for silent gene 6. silent gene Lv 1 35 pts. 10,210
  7. Avatar for ViJay7019 7. ViJay7019 Lv 1 27 pts. 10,210
  8. Avatar for Anfinsen_slept_here 8. Anfinsen_slept_here Lv 1 21 pts. 10,208
  9. Avatar for LociOiling 9. LociOiling Lv 1 16 pts. 10,039
  10. Avatar for Hellcat6 10. Hellcat6 Lv 1 12 pts. 10,020

Comments