Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,231
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,039
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 9,999
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,971
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,941
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,934
  7. Avatar for Russian team 7. Russian team 10 pts. 9,886
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,839
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,836
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,487
  1. Avatar for atlas100 121. atlas100 Lv 1 1 pt. 0
  2. Avatar for Idiotboy 122. Idiotboy Lv 1 1 pt. 0
  3. Avatar for alcor29 123. alcor29 Lv 1 1 pt. 0
  4. Avatar for rmoretti 124. rmoretti Lv 1 1 pt. 0
  5. Avatar for Hollinas 125. Hollinas Lv 1 1 pt. 0
  6. Avatar for Jaylin_M 126. Jaylin_M Lv 1 1 pt. 0
  7. Avatar for aspadistra 127. aspadistra Lv 1 1 pt. 0

Comments