Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups


  1. Avatar for Go Science 100 pts. 10,231
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,039
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 9,999
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,971
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,941
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,934
  7. Avatar for Russian team 7. Russian team 10 pts. 9,886
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,839
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,836
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,487

  1. Avatar for phi16 11. phi16 Lv 1 67 pts. 9,908
  2. Avatar for Galaxie 12. Galaxie Lv 1 64 pts. 9,898
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 61 pts. 9,895
  4. Avatar for vakobo 14. vakobo Lv 1 59 pts. 9,886
  5. Avatar for fpc 15. fpc Lv 1 56 pts. 9,882
  6. Avatar for Phyx 16. Phyx Lv 1 54 pts. 9,865
  7. Avatar for Glen B 17. Glen B Lv 1 51 pts. 9,859
  8. Avatar for Timo van der Laan 18. Timo van der Laan Lv 1 49 pts. 9,839
  9. Avatar for O Seki To 19. O Seki To Lv 1 47 pts. 9,836
  10. Avatar for frood66 20. frood66 Lv 1 45 pts. 9,807

Comments