Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups


  1. Avatar for Go Science 100 pts. 10,231
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,039
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 9,999
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,971
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,941
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,934
  7. Avatar for Russian team 7. Russian team 10 pts. 9,886
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,839
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,836
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,487

  1. Avatar for Mike Cassidy 31. Mike Cassidy Lv 1 26 pts. 9,661
  2. Avatar for Museka 32. Museka Lv 1 25 pts. 9,660
  3. Avatar for Deleted player 33. Deleted player pts. 9,642
  4. Avatar for hpaege 34. hpaege Lv 1 22 pts. 9,638
  5. Avatar for Blipperman 35. Blipperman Lv 1 21 pts. 9,622
  6. Avatar for anthion 36. anthion Lv 1 20 pts. 9,621
  7. Avatar for hansvandenhof 37. hansvandenhof Lv 1 19 pts. 9,605
  8. Avatar for kevin everington 38. kevin everington Lv 1 18 pts. 9,590
  9. Avatar for jobo0502 39. jobo0502 Lv 1 17 pts. 9,527
  10. Avatar for Pawel Tluscik 40. Pawel Tluscik Lv 1 16 pts. 9,517

Comments