Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups


  1. Avatar for Go Science 100 pts. 10,231
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,039
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 9,999
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,971
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,941
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,934
  7. Avatar for Russian team 7. Russian team 10 pts. 9,886
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,839
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,836
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,487

  1. Avatar for neon_fuzz 41. neon_fuzz Lv 1 15 pts. 9,517
  2. Avatar for id566488 42. id566488 Lv 1 14 pts. 9,506
  3. Avatar for pvc78 43. pvc78 Lv 1 14 pts. 9,503
  4. Avatar for Altercomp 44. Altercomp Lv 1 13 pts. 9,501
  5. Avatar for nicobul 45. nicobul Lv 1 12 pts. 9,490
  6. Avatar for PakElgaard 46. PakElgaard Lv 1 11 pts. 9,489
  7. Avatar for Steven Pletsch 47. Steven Pletsch Lv 1 11 pts. 9,487
  8. Avatar for ManVsYard 48. ManVsYard Lv 1 10 pts. 9,455
  9. Avatar for grogar7 49. grogar7 Lv 1 10 pts. 9,447
  10. Avatar for heather-1 50. heather-1 Lv 1 9 pts. 9,436

Comments