Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups


  1. Avatar for Go Science 100 pts. 10,231
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,039
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 9,999
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,971
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,941
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,934
  7. Avatar for Russian team 7. Russian team 10 pts. 9,886
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,839
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,836
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,487

  1. Avatar for georg137 51. georg137 Lv 1 8 pts. 9,436
  2. Avatar for CAN1958 52. CAN1958 Lv 1 8 pts. 9,411
  3. Avatar for aznarog 53. aznarog Lv 1 7 pts. 9,372
  4. Avatar for bobcat 54. bobcat Lv 1 7 pts. 9,320
  5. Avatar for Bautho 55. Bautho Lv 1 7 pts. 9,314
  6. Avatar for mereleona 56. mereleona Lv 1 6 pts. 9,300
  7. Avatar for Xyaneon 57. Xyaneon Lv 1 6 pts. 9,299
  8. Avatar for diamonddays 58. diamonddays Lv 1 5 pts. 9,292
  9. Avatar for Vinara 59. Vinara Lv 1 5 pts. 9,260
  10. Avatar for johnmitch 60. johnmitch Lv 1 5 pts. 9,253

Comments