Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,476
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 9,349
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,340
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,134
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 10,345
  2. Avatar for LociOiling 2. LociOiling Lv 1 77 pts. 10,345
  3. Avatar for toshiue 3. toshiue Lv 1 58 pts. 10,323
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 43 pts. 10,318
  5. Avatar for Hollinas 5. Hollinas Lv 1 31 pts. 10,314
  6. Avatar for pauldunn 6. pauldunn Lv 1 22 pts. 10,305
  7. Avatar for Dhalion 7. Dhalion Lv 1 15 pts. 10,300
  8. Avatar for Phyx 8. Phyx Lv 1 11 pts. 10,300
  9. Avatar for ManVsYard 9. ManVsYard Lv 1 7 pts. 10,247
  10. Avatar for Blipperman 10. Blipperman Lv 1 5 pts. 10,245

Comments