Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,476
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 9,349
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,340
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,134
  1. Avatar for momadoc 91. momadoc Lv 1 1 pt. 9,075
  2. Avatar for Auntecedent 92. Auntecedent Lv 1 1 pt. 9,057
  3. Avatar for pfirth 93. pfirth Lv 1 1 pt. 9,035
  4. Avatar for CAN1958 94. CAN1958 Lv 1 1 pt. 9,034
  5. Avatar for lconor 95. lconor Lv 1 1 pt. 9,008
  6. Avatar for roman madala 96. roman madala Lv 1 1 pt. 8,989
  7. Avatar for justjustin 97. justjustin Lv 1 1 pt. 8,970
  8. Avatar for Yali Ci 98. Yali Ci Lv 1 1 pt. 8,932
  9. Avatar for sarevok 99. sarevok Lv 1 1 pt. 8,917
  10. Avatar for Andi1960 100. Andi1960 Lv 1 1 pt. 8,903

Comments