Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,476
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 9,349
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,340
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,134
  1. Avatar for gurch 111. gurch Lv 1 1 pt. 8,560
  2. Avatar for iveenp 112. iveenp Lv 1 1 pt. 8,539
  3. Avatar for karitorikin 113. karitorikin Lv 1 1 pt. 8,498
  4. Avatar for trenz007 114. trenz007 Lv 1 1 pt. 8,438
  5. Avatar for Benthecrazy 115. Benthecrazy Lv 1 1 pt. 8,325
  6. Avatar for NinjaEule 116. NinjaEule Lv 1 1 pt. 8,303
  7. Avatar for Phillipius 117. Phillipius Lv 1 1 pt. 8,290
  8. Avatar for jtscott 118. jtscott Lv 1 1 pt. 8,081
  9. Avatar for mmoy02 119. mmoy02 Lv 1 1 pt. 7,916
  10. Avatar for Wipf 120. Wipf Lv 1 1 pt. 7,825

Comments