Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,476
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 9,349
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,340
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,134
  1. Avatar for 01010011111 121. 01010011111 Lv 1 1 pt. 7,582
  2. Avatar for luismerinoluis 122. luismerinoluis Lv 1 1 pt. 6,543
  3. Avatar for Dylancj 123. Dylancj Lv 1 1 pt. 6,523
  4. Avatar for Jakell42 124. Jakell42 Lv 1 1 pt. 6,482
  5. Avatar for Silvercraft 125. Silvercraft Lv 1 1 pt. 6,482

Comments