Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,476
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 9,349
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,340
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,134
  1. Avatar for dcrwheeler 21. dcrwheeler Lv 1 42 pts. 10,003
  2. Avatar for pvc78 22. pvc78 Lv 1 40 pts. 9,942
  3. Avatar for TastyMunchies 23. TastyMunchies Lv 1 38 pts. 9,935
  4. Avatar for nicobul 24. nicobul Lv 1 36 pts. 9,930
  5. Avatar for 181818 25. 181818 Lv 1 35 pts. 9,915
  6. Avatar for joremen 26. joremen Lv 1 33 pts. 9,914
  7. Avatar for aznarog 27. aznarog Lv 1 31 pts. 9,885
  8. Avatar for guineapig 28. guineapig Lv 1 30 pts. 9,837
  9. Avatar for georg137 29. georg137 Lv 1 28 pts. 9,834
  10. Avatar for Idiotboy 30. Idiotboy Lv 1 27 pts. 9,830

Comments