Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,476
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 9,349
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,340
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,134
  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 26 pts. 9,827
  2. Avatar for Vinara 32. Vinara Lv 1 24 pts. 9,823
  3. Avatar for neon_fuzz 33. neon_fuzz Lv 1 23 pts. 9,821
  4. Avatar for Blipperman 34. Blipperman Lv 1 22 pts. 9,806
  5. Avatar for fpc 35. fpc Lv 1 21 pts. 9,802
  6. Avatar for Pawel Tluscik 36. Pawel Tluscik Lv 1 20 pts. 9,798
  7. Avatar for hansvandenhof 37. hansvandenhof Lv 1 19 pts. 9,793
  8. Avatar for Glen B 38. Glen B Lv 1 18 pts. 9,793
  9. Avatar for Threeoak 39. Threeoak Lv 1 17 pts. 9,782
  10. Avatar for cbwest 40. cbwest Lv 1 16 pts. 9,771

Comments