Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,476
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 9,349
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,340
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,134

  1. Avatar for Hellcat6 41. Hellcat6 Lv 1 15 pts. 9,767
  2. Avatar for phi16 42. phi16 Lv 1 14 pts. 9,745
  3. Avatar for bobcat 43. bobcat Lv 1 13 pts. 9,744
  4. Avatar for MicElephant 44. MicElephant Lv 1 12 pts. 9,716
  5. Avatar for NinjaGreg 45. NinjaGreg Lv 1 12 pts. 9,697
  6. Avatar for tarimo 46. tarimo Lv 1 11 pts. 9,642
  7. Avatar for detectorist 47. detectorist Lv 1 10 pts. 9,624
  8. Avatar for Altercomp 48. Altercomp Lv 1 10 pts. 9,599
  9. Avatar for WBarme1234 49. WBarme1234 Lv 1 9 pts. 9,593
  10. Avatar for jausmh 50. jausmh Lv 1 9 pts. 9,565

Comments