Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,476
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 9,349
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,340
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,134
  1. Avatar for alwen 61. alwen Lv 1 4 pts. 9,463
  2. Avatar for libellule 62. libellule Lv 1 4 pts. 9,418
  3. Avatar for poiuytrewq987 63. poiuytrewq987 Lv 1 4 pts. 9,391
  4. Avatar for johngran 64. johngran Lv 1 3 pts. 9,389
  5. Avatar for Alistair69 65. Alistair69 Lv 1 3 pts. 9,384
  6. Avatar for Dhalion 66. Dhalion Lv 1 3 pts. 9,374
  7. Avatar for NewZealand 67. NewZealand Lv 1 3 pts. 9,349
  8. Avatar for hada 68. hada Lv 1 3 pts. 9,346
  9. Avatar for Dantoto 69. Dantoto Lv 1 2 pts. 9,341
  10. Avatar for JasperD 70. JasperD Lv 1 2 pts. 9,340

Comments