Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,476
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 9,349
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,340
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,134
  1. Avatar for rezaefar 71. rezaefar Lv 1 2 pts. 9,307
  2. Avatar for Psych0Active 72. Psych0Active Lv 1 2 pts. 9,292
  3. Avatar for manu8170 73. manu8170 Lv 1 2 pts. 9,278
  4. Avatar for toshiue 74. toshiue Lv 1 2 pts. 9,277
  5. Avatar for Vincera 75. Vincera Lv 1 2 pts. 9,246
  6. Avatar for haabermaaster 76. haabermaaster Lv 1 1 pt. 9,243
  7. Avatar for Old Chap 77. Old Chap Lv 1 1 pt. 9,243
  8. Avatar for diamonddays 78. diamonddays Lv 1 1 pt. 9,231
  9. Avatar for rabamino12358 79. rabamino12358 Lv 1 1 pt. 9,217
  10. Avatar for harvardman 80. harvardman Lv 1 1 pt. 9,212

Comments