Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,345
  2. Avatar for Go Science 2. Go Science 68 pts. 10,335
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 10,255
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,230
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,204
  6. Avatar for Russian team 6. Russian team 9 pts. 10,203
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 5 pts. 10,140
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 10,047
  9. Avatar for Contenders 9. Contenders 1 pt. 9,834
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,492
  1. Avatar for Galaxie 11. Galaxie Lv 1 66 pts. 10,140
  2. Avatar for Deleted player 12. Deleted player pts. 10,129
  3. Avatar for johnmitch 13. johnmitch Lv 1 61 pts. 10,128
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 58 pts. 10,120
  5. Avatar for Phyx 15. Phyx Lv 1 55 pts. 10,095
  6. Avatar for tamanrasset 16. tamanrasset Lv 1 53 pts. 10,083
  7. Avatar for robgee 17. robgee Lv 1 51 pts. 10,061
  8. Avatar for O Seki To 18. O Seki To Lv 1 48 pts. 10,045
  9. Avatar for grogar7 19. grogar7 Lv 1 46 pts. 10,027
  10. Avatar for Deleted player 20. Deleted player 44 pts. 10,025

Comments