Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Contenders 11. Contenders 1 pt. 9,534
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,520
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,451
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,962
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 8,688
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,479
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 7,648
  1. Avatar for O Seki To
    1. O Seki To Lv 1
    100 pts. 9,991
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 97 pts. 9,966
  3. Avatar for phi16 3. phi16 Lv 1 93 pts. 9,957
  4. Avatar for hpaege 4. hpaege Lv 1 89 pts. 9,954
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 85 pts. 9,929
  6. Avatar for LociOiling 6. LociOiling Lv 1 82 pts. 9,884
  7. Avatar for TastyMunchies 7. TastyMunchies Lv 1 78 pts. 9,854
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 75 pts. 9,846
  9. Avatar for Deleted player 9. Deleted player pts. 9,835
  10. Avatar for mberna00 10. mberna00 Lv 1 69 pts. 9,820

Comments