Placeholder image of a protein
Icon representing a puzzle

1760b: Unsolved De-novo Freestyle 157: Symmetric Trimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
November 15, 2019
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1760, which was mistakenly posted with the wrong sequence.



This is a follow-up to Puzzle 1757: De-novo Freestyle 157, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric trimer. In Puzzle 1757, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1757. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 12,631
  2. Avatar for Contenders 12. Contenders 1 pt. 12,222
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,558
  4. Avatar for Team Schleswig-Holstein 14. Team Schleswig-Holstein 1 pt. 11,108
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 10,450
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 7,763
  7. Avatar for boinc-foren.de 17. boinc-foren.de 1 pt. 675

Comments