Placeholder image of a protein
Icon representing a puzzle

1760b: Unsolved De-novo Freestyle 157: Symmetric Trimer

Closed since over 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Symmetry Symmetry

Summary


Created
November 15, 2019
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1760, which was mistakenly posted with the wrong sequence.



This is a follow-up to Puzzle 1757: De-novo Freestyle 157, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric trimer. In Puzzle 1757, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1757. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 13,737
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 13,635
  3. Avatar for Go Science 3. Go Science 52 pts. 13,474
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 13,416
  5. Avatar for Hold My Beer 5. Hold My Beer 24 pts. 13,257
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 13,225
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 13,158
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 13,084
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 12,957
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 12,670

  1. Avatar for frood66 21. frood66 Lv 1 41 pts. 12,986
  2. Avatar for Vinara 22. Vinara Lv 1 39 pts. 12,953
  3. Avatar for nicobul 23. nicobul Lv 1 37 pts. 12,902
  4. Avatar for Bruno Kestemont 24. Bruno Kestemont Lv 1 35 pts. 12,893
  5. Avatar for Mike Cassidy 25. Mike Cassidy Lv 1 33 pts. 12,883
  6. Avatar for O Seki To 26. O Seki To Lv 1 32 pts. 12,830
  7. Avatar for grogar7 27. grogar7 Lv 1 30 pts. 12,810
  8. Avatar for drumpeter18yrs9yrs 28. drumpeter18yrs9yrs Lv 1 28 pts. 12,800
  9. Avatar for cbwest 29. cbwest Lv 1 27 pts. 12,732
  10. Avatar for jobo0502 30. jobo0502 Lv 1 26 pts. 12,728

Comments