Foldit

1760b: Unsolved De-novo Freestyle 157: Symmetric Trimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary

Created: November 15, 2019
Expires: November 21, 2019 at 23:00 UTC
Max points: 100

Description

Note: This puzzle replaces Puzzle 1760, which was mistakenly posted with the wrong sequence.

This is a follow-up to Puzzle 1757: De-novo Freestyle 157, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric trimer. In Puzzle 1757, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1757. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS