Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 9,530
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,129
  3. Avatar for Contenders 13. Contenders 1 pt. 9,064
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,786
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,737
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,737
  7. Avatar for STME 1903 18. STME 1903 1 pt. 3,334

  1. Avatar for Timo van der Laan 100 pts. 10,347
  2. Avatar for LociOiling 2. LociOiling Lv 1 96 pts. 10,304
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 92 pts. 10,215
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 88 pts. 10,134
  5. Avatar for Enzyme 5. Enzyme Lv 1 85 pts. 10,127
  6. Avatar for O Seki To 6. O Seki To Lv 1 81 pts. 10,102
  7. Avatar for nicobul 7. nicobul Lv 1 78 pts. 10,084
  8. Avatar for pvc78 8. pvc78 Lv 1 74 pts. 10,057
  9. Avatar for frood66 9. frood66 Lv 1 71 pts. 10,036
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 68 pts. 10,014

Comments