Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 9,530
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,129
  3. Avatar for Contenders 13. Contenders 1 pt. 9,064
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,786
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,737
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,737
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 7,778
  8. Avatar for STME 1903 18. STME 1903 1 pt. 3,334
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,305
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 74 pts. 10,186
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 54 pts. 10,184
  4. Avatar for toshiue 4. toshiue Lv 1 38 pts. 10,175
  5. Avatar for Deleted player 5. Deleted player 27 pts. 10,166
  6. Avatar for silent gene 6. silent gene Lv 1 18 pts. 10,165
  7. Avatar for Anfinsen_slept_here 7. Anfinsen_slept_here Lv 1 12 pts. 10,144
  8. Avatar for Blipperman 8. Blipperman Lv 1 8 pts. 10,121
  9. Avatar for O Seki To 9. O Seki To Lv 1 5 pts. 10,096
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 3 pts. 10,092

Comments