Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Void Crushers 100 pts. 10,347
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 10,305
  3. Avatar for Go Science 3. Go Science 54 pts. 10,215
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 10,127
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 10,102
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,084
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,041
  8. Avatar for Anthropic Dreams 8. Anthropic Dreams 8 pts. 9,965
  9. Avatar for Russian team 9. Russian team 5 pts. 9,882
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 9,624

  1. Avatar for rws 91. rws Lv 1 1 pt. 8,131
  2. Avatar for AlecM 92. AlecM Lv 1 1 pt. 8,029
  3. Avatar for Kayoung 93. Kayoung Lv 1 1 pt. 7,996
  4. Avatar for Deleted player 94. Deleted player pts. 7,995
  5. Avatar for marcramossala 95. marcramossala Lv 1 1 pt. 7,846
  6. Avatar for Asma_Tahir 96. Asma_Tahir Lv 1 1 pt. 7,842
  7. Avatar for Bithalbierer 97. Bithalbierer Lv 1 1 pt. 7,778
  8. Avatar for sulra001 98. sulra001 Lv 1 1 pt. 7,755
  9. Avatar for jamiexq 99. jamiexq Lv 1 1 pt. 7,742
  10. Avatar for knotartist 100. knotartist Lv 1 1 pt. 7,654

Comments