Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Void Crushers 100 pts. 10,347
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 10,305
  3. Avatar for Go Science 3. Go Science 54 pts. 10,215
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 10,127
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 10,102
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,084
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,041
  8. Avatar for Anthropic Dreams 8. Anthropic Dreams 8 pts. 9,965
  9. Avatar for Russian team 9. Russian team 5 pts. 9,882
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 9,624

  1. Avatar for HWANGBO EUN 111. HWANGBO EUN Lv 1 1 pt. 7,362
  2. Avatar for urehman 112. urehman Lv 1 1 pt. 7,018
  3. Avatar for 01010011111 113. 01010011111 Lv 1 1 pt. 6,936
  4. Avatar for veronicaahui 114. veronicaahui Lv 1 1 pt. 6,914
  5. Avatar for toshiue 115. toshiue Lv 1 1 pt. 3,334
  6. Avatar for lfurgus 116. lfurgus Lv 1 1 pt. 3,334
  7. Avatar for multaq 117. multaq Lv 1 1 pt. 3,334
  8. Avatar for hansvandenhof 118. hansvandenhof Lv 1 1 pt. 3,334
  9. Avatar for bkoep 119. bkoep Lv 1 1 pt. 3,334

Comments