Placeholder image of a protein
Icon representing a puzzle

1767: Electron Density: Kinesin Coiled-Coil

Closed since over 6 years ago

Advanced Advanced Advanced Advanced Overall Overall Overall Overall Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density

Summary

Created
December 03, 2019
Expires
Max points
100
Description

Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!



Correct Sequence:


QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD
QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 13,909
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 13,900
  3. Avatar for Russian team 13. Russian team 1 pt. 13,869
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 13,741
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 12,339
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 9,792
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 8,728
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 14,269
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 97 pts. 14,260
  3. Avatar for Galaxie 3. Galaxie Lv 1 94 pts. 14,254
  4. Avatar for Susume 4. Susume Lv 1 90 pts. 14,253
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 87 pts. 14,253
  6. Avatar for Phyx 6. Phyx Lv 1 84 pts. 14,251
  7. Avatar for LociOiling 7. LociOiling Lv 1 81 pts. 14,245
  8. Avatar for grogar7 8. grogar7 Lv 1 78 pts. 14,227
  9. Avatar for Timo van der Laan 9. Timo van der Laan Lv 1 75 pts. 14,226
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 72 pts. 14,221

Comments

beta_helix Staff Lv 1

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG