Placeholder image of a protein
Icon representing a puzzle

1767: Electron Density: Kinesin Coiled-Coil

Closed since over 6 years ago

Advanced Overall Prediction Electron Density

Summary


Created
December 03, 2019
Expires
Max points
100
Description

Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!



Correct Sequence:


QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD
QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,270
  2. Avatar for Go Science 2. Go Science 74 pts. 14,269
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 14,255
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 14,226
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 14,221
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 14,220
  7. Avatar for Contenders 7. Contenders 12 pts. 14,206
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 14,191
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 13,953
  10. Avatar for Team Schleswig-Holstein 10. Team Schleswig-Holstein 3 pts. 13,918

  1. Avatar for Phyx 11. Phyx Lv 1 10 pts. 14,250
  2. Avatar for Deleted player 12. Deleted player pts. 14,247
  3. Avatar for phi16 13. phi16 Lv 1 6 pts. 14,244
  4. Avatar for ManVsYard 14. ManVsYard Lv 1 4 pts. 14,220
  5. Avatar for Skippysk8s 15. Skippysk8s Lv 1 3 pts. 14,218
  6. Avatar for alwen 16. alwen Lv 1 2 pts. 14,215
  7. Avatar for Blipperman 17. Blipperman Lv 1 2 pts. 14,204
  8. Avatar for alcor29 18. alcor29 Lv 1 1 pt. 14,199
  9. Avatar for hansvandenhof 19. hansvandenhof Lv 1 1 pt. 14,199
  10. Avatar for fpc 20. fpc Lv 1 1 pt. 14,191

Comments


beta_helix Staff Lv 1

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG