Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,596
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,258
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,184
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,528
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,125
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 7,069
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 4,765
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 0
  1. Avatar for jarbolol15 91. jarbolol15 Lv 1 1 pt. 8,128
  2. Avatar for NewZealand 92. NewZealand Lv 1 1 pt. 8,125
  3. Avatar for Sciren 93. Sciren Lv 1 1 pt. 8,102
  4. Avatar for pascal ochem 94. pascal ochem Lv 1 1 pt. 8,072
  5. Avatar for loveaabb 95. loveaabb Lv 1 1 pt. 8,015
  6. Avatar for froggs554 96. froggs554 Lv 1 1 pt. 7,960
  7. Avatar for halblauterpc 97. halblauterpc Lv 1 1 pt. 7,959
  8. Avatar for gozulio 98. gozulio Lv 1 1 pt. 7,930
  9. Avatar for hajtogato 99. hajtogato Lv 1 1 pt. 7,914
  10. Avatar for multaq 100. multaq Lv 1 1 pt. 7,894

Comments