Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,596
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,258
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,184
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,528
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,125
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 7,069
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 4,765
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 0
  1. Avatar for sielenk 111. sielenk Lv 1 1 pt. 7,420
  2. Avatar for AB_150378 112. AB_150378 Lv 1 1 pt. 7,307
  3. Avatar for roman madala 113. roman madala Lv 1 1 pt. 7,286
  4. Avatar for Alpha-KetoGlutarate1301 114. Alpha-KetoGlutarate1301 Lv 1 1 pt. 7,269
  5. Avatar for COCO592 115. COCO592 Lv 1 1 pt. 7,188
  6. Avatar for lconor 116. lconor Lv 1 1 pt. 7,072
  7. Avatar for Bithalbierer 117. Bithalbierer Lv 1 1 pt. 7,069
  8. Avatar for Biotechnologymaster 118. Biotechnologymaster Lv 1 1 pt. 7,026
  9. Avatar for 01010011111 119. 01010011111 Lv 1 1 pt. 6,948
  10. Avatar for CharlieFortsConscience 120. CharlieFortsConscience Lv 1 1 pt. 6,655

Comments