Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,596
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,258
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,184
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,528
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,125
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 7,069
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 4,765
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 0
  1. Avatar for Cyril970 121. Cyril970 Lv 1 1 pt. 5,567
  2. Avatar for davemom 122. davemom Lv 1 1 pt. 5,528
  3. Avatar for charming 123. charming Lv 1 1 pt. 5,360
  4. Avatar for RedStorm1024 124. RedStorm1024 Lv 1 1 pt. 5,187
  5. Avatar for abock 125. abock Lv 1 1 pt. 4,765
  6. Avatar for guillaumeAb 126. guillaumeAb Lv 1 1 pt. 4,758
  7. Avatar for altoid 127. altoid Lv 1 1 pt. 0
  8. Avatar for Marvelz 128. Marvelz Lv 1 1 pt. 0
  9. Avatar for Masterfolder12 129. Masterfolder12 Lv 1 1 pt. 0
  10. Avatar for kakugen 130. kakugen Lv 1 1 pt. 0

Comments