Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,596
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,258
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,184
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,528
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,125
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 7,069
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 4,765
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 0
  1. Avatar for grogar7 11. grogar7 Lv 1 68 pts. 10,251
  2. Avatar for robgee 12. robgee Lv 1 65 pts. 10,215
  3. Avatar for frood66 13. frood66 Lv 1 63 pts. 10,186
  4. Avatar for Phyx 14. Phyx Lv 1 60 pts. 10,171
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 58 pts. 10,169
  6. Avatar for johnmitch 16. johnmitch Lv 1 55 pts. 10,146
  7. Avatar for jobo0502 17. jobo0502 Lv 1 53 pts. 10,123
  8. Avatar for Idiotboy 18. Idiotboy Lv 1 51 pts. 10,117
  9. Avatar for MicElephant 19. MicElephant Lv 1 49 pts. 10,108
  10. Avatar for Deleted player 20. Deleted player 47 pts. 10,082

Comments