Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,596
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,258
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,184
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,528
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,125
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 7,069
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 4,765
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 0
  1. Avatar for vakobo 21. vakobo Lv 1 45 pts. 10,070
  2. Avatar for pvc78 22. pvc78 Lv 1 43 pts. 10,049
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 41 pts. 9,999
  4. Avatar for O Seki To 24. O Seki To Lv 1 39 pts. 9,990
  5. Avatar for drumpeter18yrs9yrs 25. drumpeter18yrs9yrs Lv 1 37 pts. 9,955
  6. Avatar for Blipperman 26. Blipperman Lv 1 36 pts. 9,912
  7. Avatar for nicobul 27. nicobul Lv 1 34 pts. 9,908
  8. Avatar for jausmh 28. jausmh Lv 1 33 pts. 9,902
  9. Avatar for guineapig 29. guineapig Lv 1 31 pts. 9,843
  10. Avatar for joremen 30. joremen Lv 1 30 pts. 9,828

Comments