Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,596
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,258
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,184
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,528
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,125
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 7,069
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 4,765
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 0
  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 28 pts. 9,803
  2. Avatar for TastyMunchies 32. TastyMunchies Lv 1 27 pts. 9,752
  3. Avatar for cbwest 33. cbwest Lv 1 26 pts. 9,746
  4. Avatar for alwen 34. alwen Lv 1 25 pts. 9,744
  5. Avatar for phi16 35. phi16 Lv 1 23 pts. 9,739
  6. Avatar for manu8170 36. manu8170 Lv 1 22 pts. 9,709
  7. Avatar for Deleted player 37. Deleted player pts. 9,662
  8. Avatar for Glen B 38. Glen B Lv 1 20 pts. 9,650
  9. Avatar for CAN1958 39. CAN1958 Lv 1 19 pts. 9,635
  10. Avatar for diamonddays 40. diamonddays Lv 1 18 pts. 9,615

Comments