Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,596
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,258
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,184
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,528
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,125
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 7,069
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 4,765
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 0
  1. Avatar for ManVsYard 51. ManVsYard Lv 1 10 pts. 9,258
  2. Avatar for vuvuvu 52. vuvuvu Lv 1 9 pts. 9,258
  3. Avatar for Pawel Tluscik 53. Pawel Tluscik Lv 1 9 pts. 9,194
  4. Avatar for hada 54. hada Lv 1 8 pts. 9,185
  5. Avatar for JasperD 55. JasperD Lv 1 8 pts. 9,184
  6. Avatar for bobcat 56. bobcat Lv 1 7 pts. 9,181
  7. Avatar for rabamino12358 57. rabamino12358 Lv 1 7 pts. 9,169
  8. Avatar for Silvercraft 58. Silvercraft Lv 1 7 pts. 9,158
  9. Avatar for Vincera 59. Vincera Lv 1 6 pts. 9,049
  10. Avatar for Merf 60. Merf Lv 1 6 pts. 9,035

Comments