Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,596
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,258
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,184
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,528
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,125
  6. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 4,765
  7. Avatar for QCNMIT 18. QCNMIT 1 pt. 0

  1. Avatar for choco-ball 71. choco-ball Lv 1 3 pts. 8,738
  2. Avatar for rinze 72. rinze Lv 1 3 pts. 8,688
  3. Avatar for RockOn 73. RockOn Lv 1 3 pts. 8,688
  4. Avatar for Threeoak 74. Threeoak Lv 1 2 pts. 8,656
  5. Avatar for pfirth 75. pfirth Lv 1 2 pts. 8,601
  6. Avatar for alrianne 76. alrianne Lv 1 2 pts. 8,599
  7. Avatar for heyubob 77. heyubob Lv 1 2 pts. 8,590
  8. Avatar for jamiexq 78. jamiexq Lv 1 2 pts. 8,575
  9. Avatar for alyssa_d_V2.0 79. alyssa_d_V2.0 Lv 1 2 pts. 8,528
  10. Avatar for lange 80. lange Lv 1 2 pts. 8,469

Comments