Placeholder image of a protein
Icon representing a puzzle

1768: Revisiting Puzzle 82: Cytotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 03, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,596
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,258
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,184
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,528
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,125
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 7,069
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 4,765
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 0
  1. Avatar for SPooks753 81. SPooks753 Lv 1 2 pts. 8,406
  2. Avatar for Willyanto 82. Willyanto Lv 1 1 pt. 8,398
  3. Avatar for SiliconDioxide 83. SiliconDioxide Lv 1 1 pt. 8,351
  4. Avatar for boondog 84. boondog Lv 1 1 pt. 8,304
  5. Avatar for Crossed Sticks 85. Crossed Sticks Lv 1 1 pt. 8,263
  6. Avatar for abiogenesis 86. abiogenesis Lv 1 1 pt. 8,257
  7. Avatar for Altercomp 87. Altercomp Lv 1 1 pt. 8,253
  8. Avatar for harvardman 88. harvardman Lv 1 1 pt. 8,184
  9. Avatar for Snowfeet 89. Snowfeet Lv 1 1 pt. 8,178
  10. Avatar for schniouf 90. schniouf Lv 1 1 pt. 8,153

Comments