Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,855
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,608
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,024
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,815
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 7,405
  6. Avatar for Team China 16. Team China 1 pt. 7,187

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 10,397
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 96 pts. 10,391
  3. Avatar for LociOiling 3. LociOiling Lv 1 92 pts. 10,388
  4. Avatar for Phyx 4. Phyx Lv 1 89 pts. 10,326
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 85 pts. 10,325
  6. Avatar for grogar7 6. grogar7 Lv 1 81 pts. 10,309
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 78 pts. 10,307
  8. Avatar for Deleted player 8. Deleted player 75 pts. 10,306
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 71 pts. 10,270
  10. Avatar for fiendish_ghoul 10. fiendish_ghoul Lv 1 68 pts. 10,251

Comments