Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,408
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,388
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 10,325
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,309
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,291
  6. Avatar for Contenders 6. Contenders 14 pts. 10,226
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,196
  8. Avatar for Russian team 8. Russian team 5 pts. 10,163
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,148
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 10,095
  1. Avatar for phi16 11. phi16 Lv 1 2 pts. 10,290
  2. Avatar for knotartist 12. knotartist Lv 1 1 pt. 10,238
  3. Avatar for robgee 13. robgee Lv 1 1 pt. 10,231
  4. Avatar for alwen 14. alwen Lv 1 1 pt. 10,227
  5. Avatar for Blipperman 15. Blipperman Lv 1 1 pt. 10,196
  6. Avatar for jausmh 16. jausmh Lv 1 1 pt. 10,171
  7. Avatar for ManVsYard 17. ManVsYard Lv 1 1 pt. 10,130
  8. Avatar for SiliconDioxide 18. SiliconDioxide Lv 1 1 pt. 10,129
  9. Avatar for alcor29 19. alcor29 Lv 1 1 pt. 10,125

Comments