Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,171
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,972
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,321
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,173
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,148
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,143
  7. Avatar for Dutch Power Cows 17. Dutch Power Cows 1 pt. 7,795

  1. Avatar for Aubade01
    1. Aubade01 Lv 1
    100 pts. 9,833
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 96 pts. 9,800
  3. Avatar for Enzyme 3. Enzyme Lv 1 92 pts. 9,793
  4. Avatar for crpainter 4. crpainter Lv 1 88 pts. 9,785
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 85 pts. 9,781
  6. Avatar for LociOiling 6. LociOiling Lv 1 81 pts. 9,779
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 77 pts. 9,752
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 74 pts. 9,740
  9. Avatar for grogar7 9. grogar7 Lv 1 71 pts. 9,738
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 68 pts. 9,725

Comments