Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,171
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,972
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,321
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,173
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,148
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,143
  7. Avatar for Dutch Power Cows 17. Dutch Power Cows 1 pt. 7,795
  1. Avatar for Louis_LIB 91. Louis_LIB Lv 1 1 pt. 7,748
  2. Avatar for deathbat_87 92. deathbat_87 Lv 1 1 pt. 7,745
  3. Avatar for boondog 93. boondog Lv 1 1 pt. 7,740
  4. Avatar for s5060557 94. s5060557 Lv 1 1 pt. 7,580
  5. Avatar for xbp 95. xbp Lv 1 1 pt. 7,550
  6. Avatar for Weizhe Zhen 96. Weizhe Zhen Lv 1 1 pt. 7,545
  7. Avatar for jcepps 97. jcepps Lv 1 1 pt. 7,437
  8. Avatar for Museka 98. Museka Lv 1 1 pt. 7,217
  9. Avatar for voron316 99. voron316 Lv 1 1 pt. 7,207
  10. Avatar for ours_bleu 100. ours_bleu Lv 1 1 pt. 7,068

Comments