Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,171
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,972
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,321
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,173
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,148
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,143
  7. Avatar for Dutch Power Cows 17. Dutch Power Cows 1 pt. 7,795
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 64 pts. 9,704
  2. Avatar for Phyx 12. Phyx Lv 1 62 pts. 9,700
  3. Avatar for johnmitch 13. johnmitch Lv 1 59 pts. 9,673
  4. Avatar for silent gene 14. silent gene Lv 1 56 pts. 9,672
  5. Avatar for jobo0502 15. jobo0502 Lv 1 53 pts. 9,658
  6. Avatar for robgee 16. robgee Lv 1 51 pts. 9,629
  7. Avatar for Deleted player 17. Deleted player pts. 9,616
  8. Avatar for Galaxie 18. Galaxie Lv 1 46 pts. 9,613
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 44 pts. 9,613
  10. Avatar for jausmh 20. jausmh Lv 1 42 pts. 9,597

Comments