Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,171
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,972
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,321
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,173
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,148
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,143
  7. Avatar for Dutch Power Cows 17. Dutch Power Cows 1 pt. 7,795
  1. Avatar for Deleted player 21. Deleted player 40 pts. 9,597
  2. Avatar for MicElephant 22. MicElephant Lv 1 38 pts. 9,589
  3. Avatar for guineapig 23. guineapig Lv 1 36 pts. 9,582
  4. Avatar for frood66 24. frood66 Lv 1 34 pts. 9,575
  5. Avatar for vakobo 25. vakobo Lv 1 32 pts. 9,567
  6. Avatar for haabermaaster 26. haabermaaster Lv 1 31 pts. 9,564
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 29 pts. 9,542
  8. Avatar for pvc78 28. pvc78 Lv 1 27 pts. 9,517
  9. Avatar for phi16 29. phi16 Lv 1 26 pts. 9,510
  10. Avatar for Blipperman 30. Blipperman Lv 1 25 pts. 9,485

Comments