Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,171
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,972
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,321
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,173
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,148
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,143
  7. Avatar for Dutch Power Cows 17. Dutch Power Cows 1 pt. 7,795
  1. Avatar for aznarog 31. aznarog Lv 1 23 pts. 9,433
  2. Avatar for alwen 32. alwen Lv 1 22 pts. 9,358
  3. Avatar for jamiexq 33. jamiexq Lv 1 21 pts. 9,350
  4. Avatar for nicobul 34. nicobul Lv 1 20 pts. 9,339
  5. Avatar for hansvandenhof 35. hansvandenhof Lv 1 18 pts. 9,317
  6. Avatar for TastyMunchies 36. TastyMunchies Lv 1 17 pts. 9,233
  7. Avatar for fpc 37. fpc Lv 1 16 pts. 9,186
  8. Avatar for O Seki To 38. O Seki To Lv 1 15 pts. 9,171
  9. Avatar for heather-1 39. heather-1 Lv 1 15 pts. 9,157
  10. Avatar for WBarme1234 40. WBarme1234 Lv 1 14 pts. 9,151

Comments