Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,171
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,972
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,321
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,173
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,148
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,143
  7. Avatar for Dutch Power Cows 17. Dutch Power Cows 1 pt. 7,795
  1. Avatar for diamonddays 41. diamonddays Lv 1 13 pts. 9,139
  2. Avatar for Glen B 42. Glen B Lv 1 12 pts. 9,111
  3. Avatar for bobcat 43. bobcat Lv 1 11 pts. 9,086
  4. Avatar for knotartist 44. knotartist Lv 1 11 pts. 9,039
  5. Avatar for CAN1958 45. CAN1958 Lv 1 10 pts. 9,029
  6. Avatar for versat82 46. versat82 Lv 1 9 pts. 8,972
  7. Avatar for pfirth 47. pfirth Lv 1 9 pts. 8,912
  8. Avatar for Merf 48. Merf Lv 1 8 pts. 8,761
  9. Avatar for Idiotboy 49. Idiotboy Lv 1 8 pts. 8,759
  10. Avatar for Vincera 50. Vincera Lv 1 7 pts. 8,736

Comments