Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,171
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,972
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,321
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,173
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,148
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,143
  7. Avatar for Dutch Power Cows 17. Dutch Power Cows 1 pt. 7,795

  1. Avatar for PeterDav 51. PeterDav Lv 1 7 pts. 8,727
  2. Avatar for dd-2 52. dd-2 Lv 1 6 pts. 8,717
  3. Avatar for detectorist 53. detectorist Lv 1 6 pts. 8,706
  4. Avatar for abiogenesis 54. abiogenesis Lv 1 5 pts. 8,703
  5. Avatar for drumpeter18yrs9yrs 55. drumpeter18yrs9yrs Lv 1 5 pts. 8,671
  6. Avatar for cbwest 56. cbwest Lv 1 5 pts. 8,612
  7. Avatar for Arne Heessels 57. Arne Heessels Lv 1 4 pts. 8,583
  8. Avatar for SiliconDioxide 58. SiliconDioxide Lv 1 4 pts. 8,559
  9. Avatar for alcor29 59. alcor29 Lv 1 4 pts. 8,552
  10. Avatar for Datstandin 60. Datstandin Lv 1 3 pts. 8,549

Comments