Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,171
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,972
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,321
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,173
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,148
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,143
  7. Avatar for Dutch Power Cows 17. Dutch Power Cows 1 pt. 7,795
  1. Avatar for johngran 61. johngran Lv 1 3 pts. 8,543
  2. Avatar for Pawel Tluscik 62. Pawel Tluscik Lv 1 3 pts. 8,528
  3. Avatar for hada 63. hada Lv 1 3 pts. 8,517
  4. Avatar for Pisqis 64. Pisqis Lv 1 3 pts. 8,492
  5. Avatar for Hellcat6 65. Hellcat6 Lv 1 2 pts. 8,490
  6. Avatar for micheldeweerd 66. micheldeweerd Lv 1 2 pts. 8,486
  7. Avatar for kevin everington 67. kevin everington Lv 1 2 pts. 8,428
  8. Avatar for rezaefar 68. rezaefar Lv 1 2 pts. 8,419
  9. Avatar for Silvercraft 69. Silvercraft Lv 1 2 pts. 8,381
  10. Avatar for rinze 70. rinze Lv 1 2 pts. 8,379

Comments