Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Go Science 100 pts. 9,833
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,793
  3. Avatar for Contenders 3. Contenders 52 pts. 9,785
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,779
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,740
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,738
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 9,708
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,658
  9. Avatar for Russian team 9. Russian team 4 pts. 9,567
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,564

  1. Avatar for PeterDav 51. PeterDav Lv 1 7 pts. 8,727
  2. Avatar for dd-2 52. dd-2 Lv 1 6 pts. 8,717
  3. Avatar for detectorist 53. detectorist Lv 1 6 pts. 8,706
  4. Avatar for abiogenesis 54. abiogenesis Lv 1 5 pts. 8,703
  5. Avatar for drumpeter18yrs9yrs 55. drumpeter18yrs9yrs Lv 1 5 pts. 8,671
  6. Avatar for cbwest 56. cbwest Lv 1 5 pts. 8,612
  7. Avatar for Arne Heessels 57. Arne Heessels Lv 1 4 pts. 8,583
  8. Avatar for SiliconDioxide 58. SiliconDioxide Lv 1 4 pts. 8,559
  9. Avatar for alcor29 59. alcor29 Lv 1 4 pts. 8,552
  10. Avatar for Datstandin 60. Datstandin Lv 1 3 pts. 8,549

Comments